Perching Stock Footage: Royalty-Free Video Clips - Page 17

Royalty-free Stock Footage Clips

white breastedperchedfinchaveschickadeewarblersongbird
Clear Filters

Media Type

NewOrientation

Resolution

Frame Rate

Duration

0:001:00+

Media Details

Usage Rights

Categories

"perching"
Footage

Seagull Perched on Chimney Beside Rooftop Antenna in Dundee

Seagull Landing on Rooftop Chimney Pots in Daylight

Blue heron perches gracefully on tree branch against a clear sky. The bird tall, slender silhouette, long neck, and sharp beak stand out

Bird Interacting with Purple Flowers

Ibis Foraging Amongst Dry Branches

Colorful Parrot Perched Outdoors

Willie Wagtail Perched on Fallen Log

Seagull Perched on a Post

Nyasa Lovebird green exotic parrot bird on stand

Seagulls Gathering by the Waterfront

Inquisitive Bird on a Rock

Bird Perched in Bare Tree Branches

Bird Interacting with Purple Flowers

Ducks and Spoonbill by Water

Australian Butcherbird Standing and Looking Around on Wooden Deck

Owl Rotating Head in Nature

Cockatoo Perched Amongst Green Foliage

Bird Perching on a Ladder Sequence

Seagull Perched on a Marine Post

Magpies Interacting on a Window Ledge

Spot-billed Duck Perched on Rock

Lorikeet Feeding on Palm Nectar

Rainbow Lorikeet Feeding on Palm

Seagulls Gathering by the Waterfront

Seagulls Perching on a Buoy

Colorful Parrots Interacting

Cockatoos Perched Amongst Green Foliage

Bird Foraging Among Purple Flowers

Spotted Munia Bird Perching Sequence

Birds Perching and Flying by Water

Cockatoo's Branch Perching Routine

Dragonfly Perched on a Pipe

Willie Wagtail Perching on Fallen Log in Natural Habitat

Bird Perched on Wooden Ladder

Slow motion of Common Kestrel (falco tinnunculus), British wildlife and birds in Richmond Park at sunset in London, England

Costa Rica Birds, Great White Heron (egretta thula) Perched Perching on a Branch, Tarcoles River Birdlife, Costa Rica Wildlife Holiday

Costa Rica Birds, Whimbrel Perched Perching on a Branch, Tarcoles River Birdlife, Puntarenas Province, Costa Rica Wildlife Holiday

Costa Rica Birds, Black Headed Trogon (trogon melanocephalus), Tropical Bird in the Forest of Carara National Park, Flying and Taking Off

Bird Silhouetted Against Sunset, Brown Pelican (pelecanus occidentalis) Silhouette Sitting on Rocks on Pacific Ocean Coast in Costa Rica

White egrets flying and perching on lush green mangrove trees, with tranquil ocean water, scattered mangrove islands, and distant mountain

Arctic tern birds perch on a wire suspended by a pole as the flock swarms

Arctic tern birds perch on a suspended wire as the flock swarms rural Iceland

Arctic tern birds perch on a wire flock swarms over nesting ground Iceland

Puffin Perching on top of Rocks on Skomer Island, Atlantic Puffin Perched on a Rock, Perching and Looking Around in Windy Weather with

Puffins on Coast with Orange Sunset Sky on Coast, Large Group of Atlantic Puffins Colony In Flight and Perching, Perched on Rocks Taking

Orange Sunset Puffin in Coastal Scenery, Atlantic Puffins Perched on Rocks, Perching at the Top of Cliffs with Orange Ocean Sea Water and

Puffins Perched on Rocks and Cliffs by the Sea on the Coast of Skomer Island, Atlantic Puffin Perched on a Rock, Perching on Cliffs with

Puffin on Rocks on Coast at Sunset, Atlantic Puffins Perching on Rocks, Perched at the Top of Cliffs with Ocean Sea Water and Coastal