Perching Stock Footage: Royalty-Free Video Clips - Page 19

Royalty-free Stock Footage Clips

white breastedperchedfinchaveschickadeewarblersongbird
Clear Filters

Media Type

NewOrientation

Resolution

Frame Rate

Duration

0:001:00+

Media Details

Usage Rights

Categories

"perching"
Footage

Pigeon Perched on Tiled Roof

Bird Foraging Among Purple Flowers

Bird Amongst Blooming Purple Flowers

Magpies Interacting by the River

Pigeon's Roof Adventure

Seagull Perched Over Waterway

Cute tiny exotic bird is sitting on branch in cage. Tropical bird in zoo.

Cockatoo Perched Amongst Green Foliage

Colorful Parrot Perched Outdoors

Magpie Movements in Sunlit Grass

Lorikeet Foraging on Palm Tree

Dragonfly Landing and Takeoff Sequence

Seagull Perched on a Post

Duck Perched on a Rock

Ibis Takes Flight from Urban Steps

Ibis at Gold Coast Park

Cockatoo Climbing in Green Foliage

Cormorant Perched on Rocky Shoreline

Bird Nesting in Palm Tree

Pigeons Perching and Flying on Rooftop

Magpies Interacting on a Glass Balustrade

Seagull's Riverside Perch

Cockatoos Taking Flight from Tree

Seagulls Perching on a Buoy

Colorful Parrot in Natural Habitat

Rainbow Lorikeet Feeding on Palm Fruit

Birds Perching on Wooden Ladder

Bird Perching Amidst Green Foliage

Seagull Perched on a Pier Post

Seagull Perched by the Water

Magpie's Urban Balcony Visit

Bird Perched on a Dock Over Water

Lorikeet Perching Amidst Urban Backdrop

Egrets Taking Flight from Tree

White-browed Woodswallow at Feeder

Pigeons Gathering and Flying Off Roof

Owl Observing Surroundings in Nature

Magpie Perching on a Tree Branch

Bird Foraging Among Purple Flowers

Rainbow Lorikeet on Palm Tree

Bird Hopping Among Tree Branches

Seagulls Perching on Dock Pillars

Seabirds Interacting on Rocky Shore

Bird Hopping on Indian Cork Tree

Owl Observing Surroundings Intently

Pelican Landing on River Branch

Bird Foraging Amongst Purple Flowers

Bird Foraging in Flowering Shrubbery