Perching Stock Footage: Royalty-Free Video Clips - Page 21

Royalty-free Stock Footage Clips

white breastedperchedfinchaveschickadeewarblersongbird
Clear Filters

Media Type

NewOrientation

Resolution

Frame Rate

Duration

0:001:00+

Media Details

Usage Rights

Categories

"perching"
Footage
NEW

Diverse women colleagues perching on wooden table in office catching up as colleague listening

NEW

Female staff by office window headband woman leading talk while hijab woman listening sharing work

NEW

House Sparrow Perched on a Tree Branch Among Lush Green Leaves

NEW

Pied Currawong Landing on Rocky Ledge in Australian Bushland

NEW

Vertical video: African American woman perching tapping cell plants shifting revealing face

Razorbills Seabirds on Rocks on the Coast, Colony of Razorbills Perching on Rocks and Swimming in the Water at Skomer Island in Wales, UK

Big Large Secretary Bird in Africa, African Birds in Serengeti National Park, Perching in a Tree Perched at the Tree Top, Africa Birds and

Lilac Breasted Roller Bird Perching on Bush in Africa, African Birds Perching on Perch on a Branch, Branches of Bushes on Wildlife Safari

Malachite Kingfisher Bird, Beautiful Bright Colourful African Birds Perching on Branch in Africa, Perched on Perch on a Branch, Branches of

Eurasian Hoopoe (Upupa epops) Perched on a Branch in the Caucasus Mountains

Mandarin Ducks Resting on Branch in Park during Daytime

Oriental Pied Hornbill Feeding Sequence

Beautiful Costa Rica Bird, Broad Billed Motmot (electron platyrhynchum), a Colourful Exotic Bird in Tropical Rainforest, Perched Perching

American Goldfinch Sitting On Birdbath In Garden Wide Shot

Mandarin duck resting quietly on a tree branch during daylight hours in a calm environment

Magpie bird moving among tree branches, natural habitat scene showing bird behavior and interaction with environment

Oriental Pied Hornbill Feeding Sequence

Galah Cockatoo Perched Amongst Leaves

Mandarin Ducks Resting on Branch in Park during Daytime

Ravens at The Tower of London

Seabirds Interacting on Coastal Rocks

Red-tailed Black Cockatoo Feeding Time

Harpy Eagle Perching and Observing

Small Sparrows Perched On Branches Against Clear Blue Sky, Delicate Green Leaves Rustling In Warm Spring Breeze Scenes Of Perching, Brief

Close-Up of a Magpie

Slow Motion Shot of Baboon walking on all fours through the lush landscape, African Wildlife in Maasai Mara National Reserve, Kenya, Africa

Seagull perching on a bush with the san francisco skyline and bay bridge in the background

Red-Tailed Black Cockatoo Feeding Sequence

Greater Kestrel perching on dead tree branch in national park with Cape turtle dove in background, african bird of prey looks around in wild

Oriental Darter Bird in Chitwan in Nepal, Aningha Birds in Chitwan National Park Perching on a Branch at a Lake, Wildlife in Nepal in Asia

Little Blue Heron (egretta caerulea), Costa Rica Birds and Wildlife, Perched Perching On a Branch in the Rainforest of Tortuguero National

Oxpecker Birds Perching on African Buffalo Back

Brown Pelican (pelecanus occidentalis), Costa Rica Birds Sitting on Rocks on the Pacific Ocean Coast with Coastal Scenery and Sea View in

Rainbow Lorikeet in Natural Habitat

Oriental Pied Hornbill Feeding Sequence

King Vulture (sarcoramphus papa), a Large Costa Rica Bird, Wildlife at Boca Tapada, Perched on a Branch in a Tree in Costa Rica, Central

Group of Sparrows Perched on Pine Branch in Berlin

Costa Rica Wildlife Bird in the Rain, Baltimore Oriel (icterus galbula), Raining on a Colourful Yellow Exotic Bird in Rainforest, Perching

Bird Foraging in Purple Flower Bush

Costa Rica Hummingbird, Fiery Throated Hummingbird (panterpe insignis) Bird Close Up Portrait Macro Detail of Colourful Feathers and Face

Slow Motion Shot of Two Baboons jumping in a tree, agressive nature fighting for territory, natural behaviour of African Wildlife in Maasai

Coastal Landscape with Atlantic Puffin Scratching Fur with Beak in Coastal Scenery, Wild Bird in Flora Cliffside Landscape in Pembrokeshire

Seagulls perching on rocky shoreline, soaring above breaking waves, diving for fish, embodying coastal wildlife freedom in serene marine

Large male green iguana resting on a sunny tree branch. Colorful reptile looking around in its natural habitat in the Sierpe mangrove forest

Colorful macaws perched on a branch in a tropical setting during the day

Pair of Colorful Rainbow Lorikeet Parrots Perched in Tropical Australian Environment

Magpies Socializing on a Glass Balcony

Pigeons on Stone Wall in Turin