Perching Stock Footage: Royalty-Free Video Clips - Page 22

Royalty-free Stock Footage Clips

white breastedperchedfinchaveschickadeewarblersongbird
Clear Filters

Media Type

NewOrientation

Resolution

Frame Rate

Duration

0:001:00+

Media Details

Usage Rights

Categories

"perching"
Footage

Black Vulture (coragyps atratus) Portrait, Costa Rica Wildlife and Birds, Perched on a Branch in a Tree with its Wings Out Drying, Boca

Stunning red eyed tree frog perched on a vibrant green leaf. Nocturnal amphibian with striking colors in its natural tropical habitat

Cockatoo Perched Amongst Green Leaves

Solitary yellow-crowned night heron perching on a thick branch in the Sierpe mangrove forest in Costa Rica, looking around its habitat

Two birds European bee-eater birds mating on a branch.

Owl Rotating Head in Nature

Close Up Beautiful Atlantic Puffin Perching on Grass and Dirt Cliff, Colourful Atlantic Ocean and Golden Cliffedge Landscape in

Blue and yellow macaws preening feathers and resting on a wooden perch in a tropical aviary at daytime

Red-tailed Black Cockatoo Feeding

Mandarin duck resting quietly on a tree branch during daylight hours in a calm environment

Asian Openbill Stork (Anastomus oscitans) perching on a tree branch with a clear blue sky background.

Snowy owl looking alert, with bright yellow eyes and white feathers, on a branch

Close Up of a Vibrant Rainbow Lorikeet Perched on a Branch

Vibrant Wildlife Scene: Elegant Insect Gliding and Perching on Flower Petals to Feed - 4K

Crows Gathering by Water Reflections

Sparrows Perched on Pine Branch in Urban Berlin Setting

Cockatoo's Perch Through Time

Bird Feeding on Purple Flowers

Cockatoos Interacting in Green Foliage

Oriental Pied Hornbill Perching

Colorful Parrot Perched Outdoors

Black crows on the asphalt in a city park. Looking for food on the ground. Wild birds close up. Bird crows corvus corax

Bird Singing Amongst Green Leaves

Green Parrots Feeding on Dense Palm Flowers

Australian Magpies Perched in Coffs Harbour Trees

Rainbow Lorikeet Feeding on Palm Tree

Bird Eurasian chaffinch perched near spring cherry blossom branch at beautiful evening sunlight.

Northern Fantail in Bangkok Park

Magpie's Exploration Around Tree

Pied crow perching on a dead tree in the Namib desert of Namibia, red sand dunes of Sossusvlei and acacia trees under a clear blue sky in

Colorful parrot grooming. Scarlet macaw engaging in mutual grooming in tropical environment. Vibrant red and blue feathered macaw

Bird Nectar Foraging in Blooming Bush

Vertical Close-Up of a White Cockatoo Grooming on a Tree Branch

European greenfinch bird singing on a branch in the evening light with audio.

Two Baboons sitting in a tree watching over the luscious African wilderness in Maasai Mara National Reserve, Kenya, Africa Safari Animals

Bird Eurasian Siskin Feeding Perched on Purple Thistle at Pleasant Sunlight.

Red Legged Honeycreeper (cyanerpes cyaneus), a Bright Blue Colourful Tropical Bird in Costa Rica, Wildlife and Rainforest Birdlife

Black vultures perched in and flying in a barren tree sun glare slow motion

Green heron perching on a fallen tree log along the rocky bank of a river. The wild bird looks around its natural habitat in Costa Rica

Owl Close Up African Bird Portrait in Africa Perched in a Tree, Verreauxs Eagle Owl, Big Owls in Tanzania in Africa at Ngorongoro

Two Rainbow Lorikeets Perched Together in a Lush Tropical Garden

Large Secretary Bird in Africa, Vertical Video for Social Media, Instagram Reels and Tiktok of Secretary Bird Perching in a Tree Top in

Bird of Prey in Chitwan Forest in Nepal, Large Bird Sitting Perching in a Tree in Chitwan National Park, Amazing Nepal Wildlife Sighting of

Bird Singing Amidst Green Foliage

Barred Owl Head-Turning Observation

Oriental Pied Hornbill Feeding Sequence

Barred Owl Head-Turning Observation

Large Owl Perching on Tree Branch, Verreauxs Eagle Owl, a Big Owl Bird in Tanzania in Africa at Ngorongoro Conservation Area in Ndutu