Perching Stock Footage: Royalty-Free Video Clips - Page 23

Royalty-free Stock Footage Clips

white breastedperchedfinchaveschickadeewarblersongbird
Clear Filters

Media Type

NewOrientation

Resolution

Frame Rate

Duration

0:001:00+

Media Details

Usage Rights

Categories

"perching"
Footage

Ibis Bird in Natural Habitat

Observing an Owl's Expressive Movements

Rainbow Lorikeets Interacting

Beautiful Little Owl Bird Sitting in Trees on Tree Branch in Colourful Forest Location, Wild Bird Blending into Woodland Branches in Dense

Gray Headed Kite (leptodon cayanensis), Costa Rica Bird of Prey and Wildlife, Birdlife Sitting on a Branch in a Tree, Birdwatching in Boca

Parrot Perched on a Tree Branch

Toucan perched on branch in dense foliage, orange bill gesturing toward companion while both scan canopy for fruit, humid sunlight filtering

Oriental Pied Hornbill Feeding Sequence

Birds living in a large green cage

Scarlet Macaw perching high in tropical foliage Costa Rica

Ring Necked Parakeets Couple, a Pair of Two Exotic Tropical Birds Mating Rituals, Perching on a Tree Branch in Richmond Park, London

Grey Heron Standing on a Railing Overlooking the Kamo River

Colorful Birds Socializing in Greenery

Costa Rica Toucan Flying, Chestnut Mandabiled Toucan (ramphastos Swainsons Toucan, ambiguus swainsonii) Taking Off from Branch in a Tree in

Oriental Pied Hornbill Feeding Sequence

Cormorant Watching Waves Crash

Parrot Perched on a Tree Branch

Bird Interacting with Purple Flowers

Australian Magpie Perched on a Diagonal Power Line Against Sky

Oriental Pied Hornbill Feeding Time

Magpie's Waterfront Snack Time

Grey headed Woodpecker on a Tree Trunk in a Winter Forest, South Ural Russia

Zebra Dove in Urban Garden

Puffin on Rocks at Top of Cliffs on Coast at Skomer Island, Atlantic Puffin Perched on a Rock, Perching and Looking Around Showing Animal

Crows Gathering and Flying in Park

Cockatoos Interacting in Forest

Magpie Movements on a Wooden Deck

Colorful Birds Perching in Green Foliage

Baboon walking on all fours through the lush landscape, African Wildlife in Maasai Mara National Reserve, Kenya, Africa Safari Animals in

Crested Terns on Rocky Shoreline

Owl Observing Surroundings in Nature

Vulture on a Tree Branch in Serengeti National Park in Tanzania in Africa, Perching and Looking Out with Clear Plain Blue Sky Background on

Flock of Cockatoos Landing in Australian Trees

Three Black Vultures (coragyps atratus) Portrait, Costa Rica Wildlife and Birds, One Flying Taking Off After Being Perched on Branch, Boca

Bird Song thrush perched on a spring branch.

Colorful Parrot Perched Outdoors

Close up of a sparrow on a blurred background

Ibis Takes Flight from Wooden Fence

Keel billed toucan perching among rainforest branches in Costa Rica

Costa Rica Fiery Throated Hummingbird (panterpe insignis) in Rainforest, Portrait of Active Birds Flying Around and Perching on a Branch

Wide of Malachite Kingfisher (Corythornis cristatus) perching on a deadwood preening itself at midday in Kenya

Acorn Woodpecker (melanerpes formicivorus) on a Tree in Costa Rica Rainforest, Beautiful Birds and Nature, Central America

Colorful Lorikeets Perched in Lush Greenery

Sulphur-Crested Cockatoo Grooming Feathers While Perched on a Tree Branch

African fish eagle perching on lush green tree branch while observing surroundings in wild savanna of Botswana, majestic bird of prey in

King Vulture (sarcoramphus papa), a Large Costa Rica Bird, Wildlife at Boca Tapada, Perched on a Branch in a Tree in Costa Rica, Central

Colorful creatures interact energetically. Vivid feathered birds congregate and communicate exuberantly outdoors. Lively and vividly hued

Chaffinch Feeding at Bird Feeder