Similar Clips

Video Details

Download Watermarked

Add to Folder

Edit in Maker

Pouring Coffee Into Cup Sequence 00:18

Contributor: BR_MEDIA

Stock video ID: SBV-352700100

4K

4KMP4 (h264) - 131.8 MB

HD

HDMOV (h264) - 6.9 MB

HD

HDMP4 (h264) - 6.9 MB

Sign Up to Download

Edit with AI

Report an Error

Related Stock Video Keywords

breakfastcafedrinkenergyglassgravityincreaseliquidmorningwake up

Browse Similar Stock Video Categories

Stock FootageFood and BeverageLifestyle